PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC02G26750.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family GRF
Protein Properties Length: 392aa    MW: 41720.6 Da    PI: 8.654
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC02G26750.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC789.3e-25123167145
              WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                      d+epgrCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  OPUNC02G26750.1 123 DPEPGRCRRTDGKKWRCSKEAAPDSKYCERHMHRGRNRSRKPVET 167
                      79****************************************997 PP

2QLQ60.93.5e-216297237
              QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                     +FTaaQ ++L++Q+l+yKyL+a++PvPp+L+++i++
  OPUNC02G26750.1 62 PFTAAQYEELEQQALIYKYLVAGVPVPPDLVLPIRR 97
                     9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.7E-116197IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.8796297IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.7E-156296IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.486123167IPR014977WRC domain
PfamPF088794.0E-21124166IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MAMPYASLSP AVADHRSSPA AATASLLPFC RSTPLSAGSG GVAMGEDAPM TARWPAAARL  60
PPFTAAQYEE LEQQALIYKY LVAGVPVPPD LVLPIRRGLD SLAARFYNHP ALGYGPYFGK  120
KLDPEPGRCR RTDGKKWRCS KEAAPDSKYC ERHMHRGRNR SRKPVETQLV AQSQPPCAVV  180
ASAAAPLAAA SNGSSFQNHS LYPAIAGSNG GGGGRNMPSS FGSALGSQLH MDNAAPYAAV  240
GGGTGKDLRY TAYGTRSLAD EHSQLITEAI NTSIENPWRL LPSQNSPFPL SSYSQLGALS  300
DLGQNSPSSL SKVKRQPLSF FGNDYAAVDS VKQENQTLRP FFDEWPKGRE SWSDLADENA  360
NLSSFSGTQL SISIPMASSD FSAASSRSTN GD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0639830.0AK063983.1 Oryza sativa Japonica Group cDNA clone:001-124-D07, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015624297.10.0PREDICTED: growth-regulating factor 4
SwissprotQ6ZIK50.0GRF4_ORYSJ; Growth-regulating factor 4
TrEMBLA0A0E0K4140.0A0A0E0K414_ORYPU; Uncharacterized protein
STRINGBGIOSGA005785-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP24633476
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.18e-50growth-regulating factor 5